Receptor Information
General Information of This Receptor
| Receptor ID |
REC00039
|
|||||
|---|---|---|---|---|---|---|
| Receptor Name |
C-X-C chemokine receptor type 4 (CXCR4)
|
|||||
| Gene Name |
CXCR4
|
|||||
| Gene ID | ||||||
| Synonym |
FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; Lipopolysaccharide-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; CD_antigen=CD184
|
|||||
| Sequence |
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Click to Show/Hide
|
|||||
| 3D Structure | ||||||
| Family |
the G-protein coupled receptor 1 family
|
|||||
| Function |
Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation . Involved in the AKT signaling cascade . Plays a role in regulation of cell migration, e.g. during wound healing . Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels . Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes . Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity). 70658, . (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env- mediated fusion of the virus.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Peptide-drug Conjuate AND It's Component Related to This Receptor
Full List of The PDC Related to This Receptor
CTCE
| PDC Info | PDC Name | Drug | Target | Linker |
|---|---|---|---|---|
|
CTCE-DTX
|
Docetaxel
|
Microtubule (MT)
|
Thiol group (SH) and maleimide
|
