Receptor Information
General Information of This Receptor
| Receptor ID |
REC00050
|
|||||
|---|---|---|---|---|---|---|
| Receptor Name |
Vesicle-associated membrane protein 8 (VAMP8)
|
|||||
| Gene Name |
VAMP8
|
|||||
| Gene ID | ||||||
| Synonym |
Endobrevin
|
|||||
| Sequence |
MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT
TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS
Click to Show/Hide
|
|||||
| 3D Structure | ||||||
| Family |
the synaptobrevin family
|
|||||
| Function |
SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. VAMP8 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane via its interaction with the STX17-SNAP29 binary t- SNARE complex . Also required for dense-granule secretion in platelets . Also plays a role in regulated enzyme secretion in pancreatic acinar cells (By similarity). Involved in the abscission of the midbody during cell division, which leads to completely separate daughter cells (By similarity). Involved in the homotypic fusion of early and late endosomes (By similarity). Participates also in the activation of type I interferon antiviral response through a TRIM6-dependent mechanism.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Peptide-drug Conjuate AND It's Component Related to This Receptor
Full List of The PDC Related to This Receptor
Cot-APTEDB
| PDC Info | PDC Name | Drug | Target | Linker |
|---|---|---|---|---|
|
Cot-APTEDB-SN38
|
7-Ethyl-10-hydroxycamptothecin
|
DNA topoisomerase 1 (TOP1)
|
Ester bond
|
