Receptor Information
General Information of This Receptor
| Receptor ID |
REC00035
|
|||||
|---|---|---|---|---|---|---|
| Receptor Name |
Caspase-3 (CASP3)
|
|||||
| Gene Name |
CASP3
|
|||||
| Gene ID | ||||||
| Synonym |
CPP32; Apopain ; Cysteine protease CPP32 ; Protein Yama ; SREBP cleavage activity 1
|
|||||
| Sequence |
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Click to Show/Hide
|
|||||
| 3D Structure | ||||||
| Family |
the peptidase C14A family
|
|||||
| Function |
Thiol protease that acts as a major effector caspase involved in the execution phase of apoptosis . Following cleavage and activation by initiator caspases (CASP8, CASP9 and/or CASP10), mediates execution of apoptosis by catalyzing cleavage of many proteins . At the onset of apoptosis, it proteolytically cleaves poly(ADP-ribose) polymerase PARP1 at a '216-Asp--Gly-217' bond . Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain (By similarity). Cleaves and activates caspase-6, -7 and -9 (CASP6, CASP7 and CASP9, respectively). Cleaves and inactivates interleukin-18 (IL18). Involved in the cleavage of huntingtin . Triggers cell adhesion in sympathetic neurons through RET cleavage . Cleaves and inhibits serine/threonine-protein kinase AKT1 in response to oxidative stress . Acts as an inhibitor of type I interferon production during virus-induced apoptosis by mediating cleavage of antiviral proteins CGAS, IRF3 and MAVS, thereby preventing cytokine overproduction . Also involved in pyroptosis by mediating cleavage and activation of gasdermin-E (GSDME). Cleaves XRCC4 and phospholipid scramblase proteins XKR4, XKR8 and XKR9, leading to promote phosphatidylserine exposure on apoptotic cell surface.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Peptide-drug Conjuate AND It's Component Related to This Receptor
Full List of The PDC Related to This Receptor
DEVD
| PDC Info | PDC Name | Drug | Target | Linker |
|---|---|---|---|---|
|
MPD1
|
Doxorubicin
|
DNA topoisomerase 2-alpha (TOP2A)
|
Amide bond
|
|
|
MPD3
|
Docetaxel
|
Microtubule (MT)
|
(4-Aminophenyl)methyl hydrogen carbonate
|
